Tesamorelin

89.00
        SPECIAL OFFER

          Please select all product options

          Product was out of stock

          share

          Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research.

          Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research.

          Description

          Tesamorelin

          Tesamorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) and is commonly utilized in biochemical and molecular research involving peptide–receptor interactions and signaling pathway analysis. In controlled laboratory settings, it is studied for its interaction with growth hormone-releasing hormone receptors (GHRH-R) and its role in intracellular signaling mechanisms within endocrine research models under defined in vitro conditions. This material is supplied in lyophilized powder form and is intended strictly for in vitro research and analytical applications.

           

          Product Name:

          Tesamorelin (Growth Hormone-Releasing Hormone Analog)

          Chemical Information:

          • Molecular Formula: C223H370N72O69S
          • Molecular Weight: 5195.9 g/mol
          • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
          • Molecular Structure:
          Molecular structure of Tesamorelin, a synthetic peptide analog of growth hormone-releasing hormone (GHRH), featuring amino acid chains and functional groups, relevant for research in growth hormone regulation and metabolic health.

          Product Description:

          Tesmorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) and is commonly utilized in biochemical and molecular research involving peptide–receptor interactions and signaling pathway analysis. In controlled laboratory settings, it is studied for its interaction with growth hormone-releasing hormone receptors (GHRH-R) and its role in intracellular signaling mechanisms within endocrine research models under defined in vitro conditions. This material is supplied in lyophilized powder form and is intended strictly for in vitro research and analytical applications.

          Research Applications:

          Tesmorelin is utilized in controlled research environments to support investigation of:

          • Growth hormone-releasing hormone receptor (GHRH-R) binding and signaling pathway analysis in isolated cell-based or cell-free in vitro assay systems
          • Peptide–receptor interaction dynamics in endocrine signaling models
          • Intracellular signaling cascade evaluation associated with peptide ligands
          • Structure-function relationships of GHRH-derived peptide analogs
          • Stability, degradation, and analytical profiling in assay-based systems

          All research applications are conducted in non-human, non-clinical experimental settings.

          Storage and Handling:

          • Store lyophilized material at −20°C (−4°F)
          • After reconstitution, store at 2–8°C (36–46°F) and use promptly
          • Avoid repeated freeze-thaw cycles
          • Maintain aseptic laboratory handling procedures

          Product Specifications:

          • Purity: ≥99% (HPLC Certified)
          • Appearance: Lyophilized white powder
          • Solubility: Soluble in suitable laboratory agents

          Compliance Notice:

          Tesmorelin is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.